Lineage for d1arzd1 (1arz D:3-130,D:241-273)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843684Protein Dihydrodipicolinate reductase [51821] (3 species)
  7. 2843685Species Escherichia coli [TaxId:562] [51822] (5 PDB entries)
  8. 2843693Domain d1arzd1: 1arz D:3-130,D:241-273 [30062]
    Other proteins in same PDB: d1arza2, d1arzb2, d1arzc2, d1arzd2
    complexed with k, nai, pdc, po4

Details for d1arzd1

PDB Entry: 1arz (more details), 2.6 Å

PDB Description: escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate
PDB Compounds: (D:) dihydrodipicolinate reductase

SCOPe Domain Sequences for d1arzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1arzd1 c.2.1.3 (D:3-130,D:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]}
danirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgvtv
qssldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaadia
ivfaanfsXmtfangavrsalwlsgkesglfdmrdvldlnnl

SCOPe Domain Coordinates for d1arzd1:

Click to download the PDB-style file with coordinates for d1arzd1.
(The format of our PDB-style files is described here.)

Timeline for d1arzd1: