SCOPe 2.02: Domain d1arzb1: 1arz B:5-130,B:241-273

Lineage for d1arzb1 (1arz B:5-130,B:241-273)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Dihydrodipicolinate reductase [51821] (3 species)

7. Species Escherichia coli [TaxId:562] [51822] (5 PDB entries)

8. Domain d1arzb1: 1arz B:5-130,B:241-273 [30060]
   Other proteins in same PDB: d1arza2, d1arzb2, d1arzc2, d1arzd2
   complexed with k, nad, pdc, po4

Details for d1arzb1

PDB Entry: 1arz, 2.6 Å

PDB Description: escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate

PDB Compounds: (B:) dihydrodipicolinate reductase

SCOPe Domain Sequences for d1arzb1:

Sequence; same for both SEQRES and ATOM records:

>d1arzb1 c.2.1.3 (B:5-130,B:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]}
nirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgvtvqs
sldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaadiaiv
faanfsXmtfangavrsalwlsgkesglfdmrdvldlnnl

Timeline for d1arzb1:

• d1arzb1 first appeared (with stable ids) in SCOP 1.55
  
• d1arzb1 appears in SCOPe 2.01
  
• d1arzb1 appears in SCOPe 2.03
  
• d1arzb1 appears in the current release, SCOPe 2.08