| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
| Protein Dihydrodipicolinate reductase [51821] (3 species) |
| Species Escherichia coli [TaxId:562] [51822] (5 PDB entries) |
| Domain d1arzb1: 1arz B:5-130,B:241-273 [30060] Other proteins in same PDB: d1arza2, d1arzb2, d1arzc2, d1arzd2 complexed with k, nai, pdc, po4 |
PDB Entry: 1arz (more details), 2.6 Å
SCOPe Domain Sequences for d1arzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1arzb1 c.2.1.3 (B:5-130,B:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]}
nirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgvtvqs
sldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaadiaiv
faanfsXmtfangavrsalwlsgkesglfdmrdvldlnnl
Timeline for d1arzb1: