Lineage for d4r38c_ (4r38 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970628Family d.110.3.0: automated matches [191387] (1 protein)
    not a true family
  6. 2970629Protein automated matches [190492] (24 species)
    not a true protein
  7. 2970698Species Erythrobacter litoralis [TaxId:314225] [261391] (1 PDB entry)
  8. 2970701Domain d4r38c_: 4r38 C: [300576]
    automated match to d2z6ca_
    complexed with rbf

Details for d4r38c_

PDB Entry: 4r38 (more details), 1.6 Å

PDB Description: lov domain from erythrobacter litoralis el346 blue-light activated histidine kinase
PDB Compounds: (C:) Blue-light-activated histidine kinase 2

SCOPe Domain Sequences for d4r38c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r38c_ d.110.3.0 (C:) automated matches {Erythrobacter litoralis [TaxId: 314225]}
lpfsltiadisqddepliyvnrafeqmtgysrssvvgrncrflqgektdpgaverlakai
rnceeveetiynyradgegfwnhllmgpledqdekcryfvgiqvdmgq

SCOPe Domain Coordinates for d4r38c_:

Click to download the PDB-style file with coordinates for d4r38c_.
(The format of our PDB-style files is described here.)

Timeline for d4r38c_: