![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
![]() | Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
![]() | Family d.110.3.0: automated matches [191387] (1 protein) not a true family |
![]() | Protein automated matches [190492] (24 species) not a true protein |
![]() | Species Erythrobacter litoralis [TaxId:314225] [261391] (1 PDB entry) |
![]() | Domain d4r38c_: 4r38 C: [300576] automated match to d2z6ca_ complexed with rbf |
PDB Entry: 4r38 (more details), 1.6 Å
SCOPe Domain Sequences for d4r38c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r38c_ d.110.3.0 (C:) automated matches {Erythrobacter litoralis [TaxId: 314225]} lpfsltiadisqddepliyvnrafeqmtgysrssvvgrncrflqgektdpgaverlakai rnceeveetiynyradgegfwnhllmgpledqdekcryfvgiqvdmgq
Timeline for d4r38c_: