Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Dihydrodipicolinate reductase [51821] (3 species) |
Species Escherichia coli [TaxId:562] [51822] (5 PDB entries) |
Domain d1drwa1: 1drw A:2-130,A:241-273 [30057] Other proteins in same PDB: d1drwa2 complexed with nhd |
PDB Entry: 1drw (more details), 2.2 Å
SCOPe Domain Sequences for d1drwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1drwa1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} hdanirvaiagaggrmgrqliqaalalegvqlgaaleregssllgsdagelagagktgvt vqssldavkddfdvfidftrpegtlnhlafcrqhgkgmvigttgfdeagkqairdaaadi aivfaanfsXmtfangavrsalwlsgkesglfdmrdvldlnnl
Timeline for d1drwa1: