![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Diaminopimelic acid dehydrogenase (DAPDH) [51819] (1 species) |
![]() | Species Corynebacterium glutamicum [TaxId:1718] [51820] (4 PDB entries) |
![]() | Domain d3dapb1: 3dap B:1-118,B:269-320 [30052] Other proteins in same PDB: d3dapa2, d3dapb2 complexed with da3, ndp |
PDB Entry: 3dap (more details), 2.2 Å
SCOPe Domain Sequences for d3dapb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dapb1 c.2.1.3 (B:1-118,B:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} mtnirvaivgygnlgrsvekliakqpdmdlvgifsrratldtktpvfdvadvdkhaddvd vlflcmgsatdipeqapkfaqfactvdtydnhrdiprhrqvmneaataagnvalvstgXr npdftassqiafgraahrmkqqgqsgaftvlevapyllspenlddliardv
Timeline for d3dapb1: