Lineage for d1e5qf1 (1e5q F:2-124,F:392-450)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308470Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 308759Protein Saccharopine reductase [51817] (1 species)
  7. 308760Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [51818] (3 PDB entries)
  8. 308766Domain d1e5qf1: 1e5q F:2-124,F:392-450 [30045]
    Other proteins in same PDB: d1e5qa2, d1e5qb2, d1e5qc2, d1e5qd2, d1e5qe2, d1e5qf2, d1e5qg2, d1e5qh2

Details for d1e5qf1

PDB Entry: 1e5q (more details), 2.1 Å

PDB Description: ternary complex of saccharopine reductase from magnaporthe grisea, nadph and saccharopine

SCOP Domain Sequences for d1e5qf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e5qf1 c.2.1.3 (F:2-124,F:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea)}
atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
eigXysamaklvgvpcavavkfvldgtisdrgvlapmnskindplmkelkekygieckek
vva

SCOP Domain Coordinates for d1e5qf1:

Click to download the PDB-style file with coordinates for d1e5qf1.
(The format of our PDB-style files is described here.)

Timeline for d1e5qf1: