![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (14 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Saccharopine reductase [51817] (1 species) |
![]() | Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [51818] (3 PDB entries) |
![]() | Domain d1e5qb1: 1e5q B:2-124,B:392-450 [30041] Other proteins in same PDB: d1e5qa2, d1e5qb2, d1e5qc2, d1e5qd2, d1e5qe2, d1e5qf2, d1e5qg2, d1e5qh2 |
PDB Entry: 1e5q (more details), 2.1 Å
SCOP Domain Sequences for d1e5qb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e5qb1 c.2.1.3 (B:2-124,B:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea)} atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn eigXysamaklvgvpcavavkfvldgtisdrgvlapmnskindplmkelkekygieckek vva
Timeline for d1e5qb1: