Lineage for d1ff9a1 (1ff9 A:2-124,A:392-450)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575085Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (18 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 575487Protein Saccharopine reductase [51817] (1 species)
  7. 575488Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [51818] (3 PDB entries)
  8. 575489Domain d1ff9a1: 1ff9 A:2-124,A:392-450 [30039]
    Other proteins in same PDB: d1ff9a2
    complexed with so4

Details for d1ff9a1

PDB Entry: 1ff9 (more details), 2 Å

PDB Description: apo saccharopine reductase

SCOP Domain Sequences for d1ff9a1:

Sequence, based on SEQRES records: (download)

>d1ff9a1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea)}
atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
eigXysamaklvgvpcavavkfvldgtisdrgvlapmnskindplmkelkekygieckek
vva

Sequence, based on observed residues (ATOM records): (download)

>d1ff9a1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea)}
atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
ldaevakhdlvislipfhatviksairqkkhvvttsyvspammeldqaakdagitvmnei
gXysamaklvgvpcavavkfvldgtisdrgvlapmnskindplmkelkekygieckekvv
a

SCOP Domain Coordinates for d1ff9a1:

Click to download the PDB-style file with coordinates for d1ff9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ff9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ff9a2