Lineage for d1ff9a1 (1ff9 A:2-124,A:392-450)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20314Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 20469Protein Saccharopine reductase [51817] (1 species)
  7. 20470Species Rice blast fungus (Magnaporthe grisea) [TaxId:148305] [51818] (3 PDB entries)
  8. 20471Domain d1ff9a1: 1ff9 A:2-124,A:392-450 [30039]
    Other proteins in same PDB: d1ff9a2

Details for d1ff9a1

PDB Entry: 1ff9 (more details), 2 Å

PDB Description: apo saccharopine reductase
PDB Compounds: (A:)

SCOP Domain Sequences for d1ff9a1:

Sequence, based on SEQRES records: (download)

>d1ff9a1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea)}
atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
ldaevakhdlvislipytfhatviksairqkkhvvttsyvspammeldqaakdagitvmn
eigXysamaklvgvpcavavkfvldgtisdrgvlapmnskindplmkelkekygieckek
vva

Sequence, based on observed residues (ATOM records): (download)

>d1ff9a1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea)}
atksvlmlgsgfvtrptldvltdsgikvtvacrtlesakklsagvqhstpisldvnddaa
ldaevakhdlvislipfhatviksairqkkhvvttsyvspammeldqaakdagitvmnei
gXysamaklvgvpcavavkfvldgtisdrgvlapmnskindplmkelkekygieckekvv
a

SCOP Domain Coordinates for d1ff9a1:

Click to download the PDB-style file with coordinates for d1ff9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ff9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ff9a2