Lineage for d1ebua1 (1ebu A:2-150,A:341-359)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1829107Protein Homoserine dehydrogenase [51815] (1 species)
  7. 1829108Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51816] (4 PDB entries)
    Uniprot P31116
  8. 1829111Domain d1ebua1: 1ebu A:2-150,A:341-359 [30035]
    Other proteins in same PDB: d1ebua2, d1ebub2, d1ebuc2, d1ebud2
    complexed with hse, na, nda

Details for d1ebua1

PDB Entry: 1ebu (more details), 2.6 Å

PDB Description: homoserine dehydrogenase complex with nad analogue and l-homoserine
PDB Compounds: (A:) homoserine dehydrogenase

SCOPe Domain Sequences for d1ebua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ebua1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stkvvnvavigagvvgsafldqllamkstitynlvllaeaersliskdfsplnvgsdwka
alaasttktlplddliahlktspkpvilvdntssayiagfytkfvengisiatpnkkafs
sdlatwkalfsnkptngfvyheatvgaglXaavtaagvlgdvikiaqrl

SCOPe Domain Coordinates for d1ebua1:

Click to download the PDB-style file with coordinates for d1ebua1.
(The format of our PDB-style files is described here.)

Timeline for d1ebua1: