SCOP 1.69: Domain d1ebfb1: 1ebf B:2-150,B:341-359

Lineage for d1ebfb1 (1ebf B:2-150,B:341-359)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (17 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Homoserine dehydrogenase [51815] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [51816] (4 PDB entries)

8. Domain d1ebfb1: 1ebf B:2-150,B:341-359 [30034]
   Other proteins in same PDB: d1ebfa2, d1ebfb2

Details for d1ebfb1

PDB Entry: 1ebf, 2.3 Å

PDB Description: homoserine dehydrogenase from s. cerevisiae complex with nad+

SCOP Domain Sequences for d1ebfb1:

Sequence; same for both SEQRES and ATOM records:

>d1ebfb1 c.2.1.3 (B:2-150,B:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae)}
stkvvnvavigagvvgsafldqllamkstitynlvllaeaersliskdfsplnvgsdwka
alaasttktlplddliahlktspkpvilvdntssayiagfytkfvengisiatpnkkafs
sdlatwkalfsnkptngfvyheatvgaglXaavtaagvlgdvikiaqrl

Timeline for d1ebfb1:

• d1ebfb1 first appeared (with stable ids) in SCOP 1.55
  
• d1ebfb1 appears in SCOP 1.67
  
• d1ebfb1 appears in SCOP 1.71
  
• d1ebfb1 appears in the current release, SCOPe 2.08