Lineage for d1brmc1 (1brm C:1-133,C:355-367)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2104791Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2104834Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)
  7. 2104835Species Escherichia coli [TaxId:562] [51814] (4 PDB entries)
    Uniprot P00353
  8. 2104845Domain d1brmc1: 1brm C:1-133,C:355-367 [30032]
    Other proteins in same PDB: d1brma2, d1brmb2, d1brmc2

Details for d1brmc1

PDB Entry: 1brm (more details), 2.5 Å

PDB Description: aspartate beta-semialdehyde dehydrogenase from escherichia coli
PDB Compounds: (C:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1brmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brmc1 c.2.1.3 (C:1-133,C:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]}
mknvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
dglnngirtfvggXaaeplrrmlrqla

SCOPe Domain Coordinates for d1brmc1:

Click to download the PDB-style file with coordinates for d1brmc1.
(The format of our PDB-style files is described here.)

Timeline for d1brmc1: