Lineage for d1brmb1 (1brm B:1-133,B:355-367)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66547Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 66548Protein Aspartate beta-semialdehyde dehydrogenase [51813] (1 species)
  7. 66549Species Escherichia coli [TaxId:562] [51814] (1 PDB entry)
  8. 66551Domain d1brmb1: 1brm B:1-133,B:355-367 [30031]
    Other proteins in same PDB: d1brma2, d1brmb2, d1brmc2

Details for d1brmb1

PDB Entry: 1brm (more details), 2.5 Å

PDB Description: aspartate beta-semialdehyde dehydrogenase from escherichia coli

SCOP Domain Sequences for d1brmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1brmb1 c.2.1.3 (B:1-133,B:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli}
mknvgfigwrgmvgsvlmqrmveerdfdairpvffstsqlgqaapsfggttgtlqdafdl
ealkaldiivtcqggdytneiypklresgwqgywidaasslrmkddaiiildpvnqdvit
dglnngirtfvggXaaeplrrmlrqla

SCOP Domain Coordinates for d1brmb1:

Click to download the PDB-style file with coordinates for d1brmb1.
(The format of our PDB-style files is described here.)

Timeline for d1brmb1: