Lineage for d3gpdg1 (3gpd G:1-150,G:315-334)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20314Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 20369Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species)
  7. 20408Species Human (Homo sapiens) [TaxId:9606] [51812] (1 PDB entry)
  8. 20409Domain d3gpdg1: 3gpd G:1-150,G:315-334 [30029]
    Other proteins in same PDB: d3gpdg2, d3gpdr2

Details for d3gpdg1

PDB Entry: 3gpd (more details), 3.5 Å

PDB Description: twinning in crystals of human skeletal muscle d-glyceraldehyde-3- phosphate dehydrogenase
PDB Compounds: (G:)

SCOP Domain Sequences for d3gpdg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gpdg1 c.2.1.3 (G:1-150,G:315-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human (Homo sapiens)}
gkvkvgvdgfgrigrlvtraafnsgkvdivaindpfidlhymvymfqydsthgkfhgtvk
aedgklvidgkaitifqerdpenikwgdagtayvvestgvfttmekagahlkggakrivi
sapsadapmfvmgvnhfkyanslkiisnasXnefgyservvdlmahmaske

SCOP Domain Coordinates for d3gpdg1:

Click to download the PDB-style file with coordinates for d3gpdg1.
(The format of our PDB-style files is described here.)

Timeline for d3gpdg1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gpdg2