Lineage for d3gpdr1 (3gpd R:1-150,R:315-334)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828863Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1828939Species Human (Homo sapiens) [TaxId:9606] [51812] (1 PDB entry)
  8. 1828941Domain d3gpdr1: 3gpd R:1-150,R:315-334 [30028]
    Other proteins in same PDB: d3gpdg2, d3gpdr2
    complexed with nad, so4

Details for d3gpdr1

PDB Entry: 3gpd (more details), 3.5 Å

PDB Description: twinning in crystals of human skeletal muscle d-glyceraldehyde-3- phosphate dehydrogenase
PDB Compounds: (R:) d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d3gpdr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gpdr1 c.2.1.3 (R:1-150,R:315-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human (Homo sapiens) [TaxId: 9606]}
gkvkvgvdgfgrigrlvtraafnsgkvdivaindpfidlhymvymfqydsthgkfhgtvk
aedgklvidgkaitifqerdpenikwgdagtayvvestgvfttmekagahlkggakrivi
sapsadapmfvmgvnhfkyanslkiisnasXnefgyservvdlmahmaske

SCOPe Domain Coordinates for d3gpdr1:

Click to download the PDB-style file with coordinates for d3gpdr1.
(The format of our PDB-style files is described here.)

Timeline for d3gpdr1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gpdr2