SCOPe 2.07: Domain d1crwr1: 1crw R:1-148,R:313-334

Lineage for d1crwr1 (1crw R:1-148,R:313-334)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)

7. Species South China Sea lobster (Palinurus versicolor) [TaxId:150436] [51811] (5 PDB entries)

8. Domain d1crwr1: 1crw R:1-148,R:313-334 [30027]
   Other proteins in same PDB: d1crwg2, d1crwr2

Details for d1crwr1

PDB Entry: 1crw, 2 Å

PDB Description: crystal structure of apo-glyceraldehyde-3-phosphate dehydrogenase from palinurus versicolor at 2.0a resolution

PDB Compounds: (R:) d-glyceraldehyde-3-phosphate-dehydrogenase

SCOPe Domain Sequences for d1crwr1:

Sequence; same for both SEQRES and ATOM records:

>d1crwr1 c.2.1.3 (R:1-148,R:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]}
skigingfgrigrlvlraalemgaqvvavndpfialeymvymfkydsthgmfkgevkaed
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
sadapmfvcgvnlekyskdmkvvsnasXnefgysqrvidlikhmqkvdsa

Timeline for d1crwr1:

• d1crwr1 first appeared (with stable ids) in SCOP 1.55
  
• d1crwr1 appears in SCOPe 2.06
  
• d1crwr1 appears in the current release, SCOPe 2.08