Lineage for d1crwr1 (1crw R:1-148,R:313-334)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66547Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 66608Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species)
  7. 66673Species Lobster (Palinurus versicolor) [51811] (3 PDB entries)
  8. 66677Domain d1crwr1: 1crw R:1-148,R:313-334 [30027]
    Other proteins in same PDB: d1crwg2, d1crwr2

Details for d1crwr1

PDB Entry: 1crw (more details), 2 Å

PDB Description: crystal structure of apo-glyceraldehyde-3-phosphate dehydrogenase from palinurus versicolor at 2.0a resolution

SCOP Domain Sequences for d1crwr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1crwr1 c.2.1.3 (R:1-148,R:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Palinurus versicolor)}
skigingfgrigrlvlraalemgaqvvavndpfialeymvymfkydsthgmfkgevkaed
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
sadapmfvcgvnlekyskdmkvvsnasXnefgysqrvidlikhmqkvdsa

SCOP Domain Coordinates for d1crwr1:

Click to download the PDB-style file with coordinates for d1crwr1.
(The format of our PDB-style files is described here.)

Timeline for d1crwr1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1crwr2