Lineage for d1crwg1 (1crw G:1-148,G:313-334)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828863Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1828979Species South China Sea lobster (Palinurus versicolor) [TaxId:150436] [51811] (5 PDB entries)
  8. 1828982Domain d1crwg1: 1crw G:1-148,G:313-334 [30026]
    Other proteins in same PDB: d1crwg2, d1crwr2

Details for d1crwg1

PDB Entry: 1crw (more details), 2 Å

PDB Description: crystal structure of apo-glyceraldehyde-3-phosphate dehydrogenase from palinurus versicolor at 2.0a resolution
PDB Compounds: (G:) d-glyceraldehyde-3-phosphate-dehydrogenase

SCOPe Domain Sequences for d1crwg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1crwg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]}
skigingfgrigrlvlraalemgaqvvavndpfialeymvymfkydsthgmfkgevkaed
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkviisap
sadapmfvcgvnlekyskdmkvvsnasXnefgysqrvidlikhmqkvdsa

SCOPe Domain Coordinates for d1crwg1:

Click to download the PDB-style file with coordinates for d1crwg1.
(The format of our PDB-style files is described here.)

Timeline for d1crwg1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1crwg2