SCOPe 2.07: Domain d4pj0x_: 4pj0 X:

Lineage for d4pj0x_ (4pj0 X:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family)
   Pfam PF06596

5. Family f.23.40.1: PsbX-like [267615] (2 proteins)

6. Protein automated matches [267680] (2 species)
   not a true protein

7. Species Thermosynechococcus elongatus [TaxId:197221] [311275] (8 PDB entries)

8. Domain d4pj0x_: 4pj0 X: [300249]
   Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0z_
   automated match to d4il6x_
   complexed with bcr, bct, cl, cla, dgd, fe, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl

Details for d4pj0x_

PDB Entry: 4pj0, 2.44 Å

PDB Description: Structure of T.elongatus Photosystem II, rows of dimers crystal packing

PDB Compounds: (X:) Photosystem II reaction center X protein

SCOPe Domain Sequences for d4pj0x_:

Sequence; same for both SEQRES and ATOM records:

>d4pj0x_ f.23.40.1 (X:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
titpslkgffigllsgavvlgltfavliaisqidkvq

Timeline for d4pj0x_:

• d4pj0x_ first appeared in SCOPe 2.06