Lineage for d4pj0x_ (4pj0 X:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026852Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 3026853Family f.23.40.1: PsbX-like [267615] (2 proteins)
  6. 3026857Protein automated matches [267680] (2 species)
    not a true protein
  7. 3026858Species Thermosynechococcus elongatus [TaxId:197221] [311275] (12 PDB entries)
  8. 3026862Domain d4pj0x_: 4pj0 X: [300249]
    Other proteins in same PDB: d4pj0a_, d4pj0b_, d4pj0c_, d4pj0d_, d4pj0e_, d4pj0f_, d4pj0h_, d4pj0i_, d4pj0j_, d4pj0k_, d4pj0l_, d4pj0m_, d4pj0o_, d4pj0t_, d4pj0u_, d4pj0v_, d4pj0z_
    automated match to d4il6x_
    complexed with bcr, bct, cl, cla, dgd, fe, hec, hem, lhg, lmg, oex, pho, pl9, so4, sqd, unl

Details for d4pj0x_

PDB Entry: 4pj0 (more details), 2.44 Å

PDB Description: structure of t.elongatus photosystem ii, rows of dimers crystal packing
PDB Compounds: (X:) Photosystem II reaction center X protein

SCOPe Domain Sequences for d4pj0x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj0x_ f.23.40.1 (X:) automated matches {Thermosynechococcus elongatus [TaxId: 197221]}
titpslkgffigllsgavvlgltfavliaisqidkvq

SCOPe Domain Coordinates for d4pj0x_:

Click to download the PDB-style file with coordinates for d4pj0x_.
(The format of our PDB-style files is described here.)

Timeline for d4pj0x_: