Lineage for d4ph0f2 (4ph0 F:127-206)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706557Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2706558Protein automated matches [191156] (12 species)
    not a true protein
  7. 2706559Species Bovine leukemia virus [TaxId:11901] [273638] (1 PDB entry)
  8. 2706565Domain d4ph0f2: 4ph0 F:127-206 [300224]
    Other proteins in same PDB: d4ph0a1, d4ph0b1, d4ph0c1, d4ph0d1, d4ph0e1, d4ph0f1
    automated match to d4ph0a2

Details for d4ph0f2

PDB Entry: 4ph0 (more details), 2.75 Å

PDB Description: capsid protein from bovine leukemia virus
PDB Compounds: (F:) BLV capsid

SCOPe Domain Sequences for d4ph0f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ph0f2 a.28.3.0 (F:127-206) automated matches {Bovine leukemia virus [TaxId: 11901]}
rpsvqpwstivqgpaesyvefvnrlqisladnlpdgvpkepiidslsyanankecqqilq
grglvaapvgqklqacahwa

SCOPe Domain Coordinates for d4ph0f2:

Click to download the PDB-style file with coordinates for d4ph0f2.
(The format of our PDB-style files is described here.)

Timeline for d4ph0f2: