Lineage for d1gpdr1 (1gpd R:1-148,R:313-334)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1828622Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1828863Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1828867Species American lobster (Homarus americanus) [TaxId:6706] [51810] (2 PDB entries)
  8. 1828869Domain d1gpdr1: 1gpd R:1-148,R:313-334 [30021]
    Other proteins in same PDB: d1gpdg2, d1gpdr2
    complexed with nad, po4

Details for d1gpdr1

PDB Entry: 1gpd (more details), 2.9 Å

PDB Description: studies of asymmetry in the three-dimensional structure of lobster d-glyceraldehyde-3-phosphate dehydrogenase
PDB Compounds: (R:) d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1gpdr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpdr1 c.2.1.3 (R:1-148,R:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {American lobster (Homarus americanus) [TaxId: 6706]}
skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
sadapmfvcgvnlekyskdmtvvsnasXnefgysqrvidllkhmqkvdsa

SCOPe Domain Coordinates for d1gpdr1:

Click to download the PDB-style file with coordinates for d1gpdr1.
(The format of our PDB-style files is described here.)

Timeline for d1gpdr1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gpdr2