SCOPe 2.06: Domain d1gpdg1: 1gpd G:1-148,G:313-334

Lineage for d1gpdg1 (1gpd G:1-148,G:313-334)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (20 species)

7. Species American lobster (Homarus americanus) [TaxId:6706] [51810] (2 PDB entries)

8. Domain d1gpdg1: 1gpd G:1-148,G:313-334 [30020]
   Other proteins in same PDB: d1gpdg2, d1gpdr2
   complexed with nad, po4

Details for d1gpdg1

PDB Entry: 1gpd, 2.9 Å

PDB Description: studies of asymmetry in the three-dimensional structure of lobster d-glyceraldehyde-3-phosphate dehydrogenase

PDB Compounds: (G:) d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1gpdg1:

Sequence; same for both SEQRES and ATOM records:

>d1gpdg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {American lobster (Homarus americanus) [TaxId: 6706]}
skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
sadapmfvcgvnlekyskdmtvvsnasXnefgysqrvidllkhmqkvdsa

Timeline for d1gpdg1:

• d1gpdg1 first appeared (with stable ids) in SCOP 1.55
  
• d1gpdg1 appears in SCOPe 2.05
  
• d1gpdg1 appears in SCOPe 2.07
  
• d1gpdg1 appears in the current release, SCOPe 2.08