Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (14 species) |
Species Lobster (Homarus americanus) [51810] (2 PDB entries) |
Domain d1gpdg1: 1gpd G:1-148,G:313-334 [30020] Other proteins in same PDB: d1gpdg2, d1gpdr2 |
PDB Entry: 1gpd (more details), 2.9 Å
SCOP Domain Sequences for d1gpdg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gpdg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Homarus americanus)} skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap sadapmfvcgvnlekyskdmtvvsnasXnefgysqrvidllkhmqkvdsa
Timeline for d1gpdg1: