Lineage for d1gpdg1 (1gpd G:1-148,G:313-334)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308470Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 308576Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (14 species)
  7. 308670Species Lobster (Homarus americanus) [51810] (2 PDB entries)
  8. 308675Domain d1gpdg1: 1gpd G:1-148,G:313-334 [30020]
    Other proteins in same PDB: d1gpdg2, d1gpdr2

Details for d1gpdg1

PDB Entry: 1gpd (more details), 2.9 Å

PDB Description: studies of asymmetry in the three-dimensional structure of lobster d-glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d1gpdg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gpdg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Homarus americanus)}
skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
sadapmfvcgvnlekyskdmtvvsnasXnefgysqrvidllkhmqkvdsa

SCOP Domain Coordinates for d1gpdg1:

Click to download the PDB-style file with coordinates for d1gpdg1.
(The format of our PDB-style files is described here.)

Timeline for d1gpdg1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gpdg2