Lineage for d4gpd41 (4gpd 4:1-147,4:312-333)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1150729Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1150730Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1152379Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1152583Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1152587Species American lobster (Homarus americanus) [TaxId:6706] [51810] (2 PDB entries)
  8. 1152591Domain d4gpd41: 4gpd 4:1-147,4:312-333 [30019]
    Other proteins in same PDB: d4gpd12, d4gpd22, d4gpd32, d4gpd42

Details for d4gpd41

PDB Entry: 4gpd (more details), 2.8 Å

PDB Description: the structure of lobster apo-d-glyceraldehyde-3-phosphate dehydrogenase at 3.0 angstroms resolution
PDB Compounds: (4:) apo-d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d4gpd41:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gpd41 c.2.1.3 (4:1-147,4:312-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {American lobster (Homarus americanus) [TaxId: 6706]}
skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
sadapmfvcgvnlekyskdmtvvsnasXnefgysqrvidllkhmqkvdsa

SCOPe Domain Coordinates for d4gpd41:

Click to download the PDB-style file with coordinates for d4gpd41.
(The format of our PDB-style files is described here.)

Timeline for d4gpd41: