Lineage for d4gpd41 (4gpd 4:1-147,4:312-333)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118409Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (10 proteins)
  6. 118495Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (12 species)
  7. 118570Species Lobster (Homarus americanus) [51810] (2 PDB entries)
  8. 118574Domain d4gpd41: 4gpd 4:1-147,4:312-333 [30019]
    Other proteins in same PDB: d4gpd12, d4gpd22, d4gpd32, d4gpd42

Details for d4gpd41

PDB Entry: 4gpd (more details), 2.8 Å

PDB Description: the structure of lobster apo-d-glyceraldehyde-3-phosphate dehydrogenase at 3.0 angstroms resolution

SCOP Domain Sequences for d4gpd41:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gpd41 c.2.1.3 (4:1-147,4:312-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Homarus americanus)}
skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
sadapmfvcgvnlekyskdmtvvsnasXnefgysqrvidllkhmqkvdsa

SCOP Domain Coordinates for d4gpd41:

Click to download the PDB-style file with coordinates for d4gpd41.
(The format of our PDB-style files is described here.)

Timeline for d4gpd41: