SCOP 1.65: Domain d4gpd21: 4gpd 2:1-147,2:312-333

Lineage for d4gpd21 (4gpd 2:1-147,2:312-333)

Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
The nucleotide-binding modes of this and the next two folds/superfamilies are similar

Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families)
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
family members also share a common alpha+beta fold in C-terminal domain
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (14 species)
Species Lobster (Homarus americanus) [51810] (2 PDB entries)
Domain d4gpd21: 4gpd 2:1-147,2:312-333 [30017]
Other proteins in same PDB: d4gpd12, d4gpd22, d4gpd32, d4gpd42

Details for d4gpd21

PDB Entry: 4gpd (more details), 2.8 Å

PDB Description: the structure of lobster apo-d-glyceraldehyde-3-phosphate dehydrogenase at 3.0 angstroms resolution

SCOP Domain Sequences for d4gpd21:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gpd21 c.2.1.3 (2:1-147,2:312-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Lobster (Homarus americanus)}
skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
sadapmfvcgvnlekyskdmtvvsnasXnefgysqrvidllkhmqkvdsa

SCOP Domain Coordinates for d4gpd21:

Click to download the PDB-style file with coordinates for d4gpd21.
(The format of our PDB-style files is described here.)

Timeline for d4gpd21: