SCOPe 2.08: Domain d4p4kg2: 4p4k G:117-205

Lineage for d4p4kg2 (4p4k G:117-205)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d4p4kg2: 4p4k G:117-205 [300163]
   Other proteins in same PDB: d4p4ka1, d4p4ka2, d4p4kc1, d4p4kd1, d4p4ke1, d4p4ke2, d4p4kg1, d4p4kh1
   automated match to d4eura2
   complexed with 0be, na, nag

Details for d4p4kg2

PDB Entry: 4p4k, 2.8 Å

PDB Description: structural basis of chronic beryllium disease: bridging the gap between allergic hypersensitivity and auto immunity

PDB Compounds: (G:) hTCRav22 alpha chain

SCOPe Domain Sequences for d4p4kg2:

Sequence; same for both SEQRES and ATOM records:

>d4p4kg2 b.1.1.2 (G:117-205) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Timeline for d4p4kg2:

• d4p4kg2 first appeared in SCOPe 2.06
  
• d4p4kg2 appears in SCOPe 2.07