Lineage for d4gpd11 (4gpd 1:1-147,1:312-333)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2104791Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2105032Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (20 species)
  7. 2105036Species American lobster (Homarus americanus) [TaxId:6706] [51810] (2 PDB entries)
  8. 2105039Domain d4gpd11: 4gpd 1:1-147,1:312-333 [30016]
    Other proteins in same PDB: d4gpd12, d4gpd22, d4gpd32, d4gpd42

Details for d4gpd11

PDB Entry: 4gpd (more details), 2.8 Å

PDB Description: the structure of lobster apo-d-glyceraldehyde-3-phosphate dehydrogenase at 3.0 angstroms resolution
PDB Compounds: (1:) apo-d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d4gpd11:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gpd11 c.2.1.3 (1:1-147,1:312-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {American lobster (Homarus americanus) [TaxId: 6706]}
skigingfgrigrlvlraalscgaqvvavndpfialeymvymfkydsthgvfkgevkmed
galvvdgkkitvfnemkpenipwskagaeyivestgvfttiekasahfkggakkvvisap
sadapmfvcgvnlekyskdmtvvsnasXnefgysqrvidllkhmqkvdsa

SCOPe Domain Coordinates for d4gpd11:

Click to download the PDB-style file with coordinates for d4gpd11.
(The format of our PDB-style files is described here.)

Timeline for d4gpd11: