Lineage for d1gyqd1 (1gyq D:1-165,D:335-358)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66547Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 66608Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species)
  7. 66653Species Leishmania mexicana [TaxId:5665] [51809] (3 PDB entries)
  8. 66665Domain d1gyqd1: 1gyq D:1-165,D:335-358 [30015]
    Other proteins in same PDB: d1gyqa2, d1gyqb2, d1gyqc2, d1gyqd2

Details for d1gyqd1

PDB Entry: 1gyq (more details), 3.4 Å

PDB Description: crystal structure of glycosomal glyceraldehyde from leishmania mexicana in complex with n6-benzyl-nad
PDB Compounds: (D:)

SCOP Domain Sequences for d1gyqd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyqd1 c.2.1.3 (D:1-165,D:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana}
apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr
ymaakdaass

SCOP Domain Coordinates for d1gyqd1:

Click to download the PDB-style file with coordinates for d1gyqd1.
(The format of our PDB-style files is described here.)

Timeline for d1gyqd1: