Lineage for d1gyqa1 (1gyq A:1-165,A:335-358)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2451891Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2452132Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)
  7. 2452365Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51809] (5 PDB entries)
  8. 2452386Domain d1gyqa1: 1gyq A:1-165,A:335-358 [30012]
    Other proteins in same PDB: d1gyqa2, d1gyqb2, d1gyqc2, d1gyqd2
    complexed with nbd

Details for d1gyqa1

PDB Entry: 1gyq (more details), 3.4 Å

PDB Description: crystal structure of glycosomal glyceraldehyde from leishmania mexicana in complex with n6-benzyl-nad
PDB Compounds: (A:) protein (glyceraldehyde-3-phosphate dehydrogenase)

SCOPe Domain Sequences for d1gyqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyqa1 c.2.1.3 (A:1-165,A:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr
ymaakdaass

SCOPe Domain Coordinates for d1gyqa1:

Click to download the PDB-style file with coordinates for d1gyqa1.
(The format of our PDB-style files is described here.)

Timeline for d1gyqa1: