Lineage for d1gyqa1 (1gyq A:1-165,A:335-358)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20314Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 20369Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species)
  7. 20411Species Leishmania mexicana [TaxId:5665] [51809] (3 PDB entries)
  8. 20420Domain d1gyqa1: 1gyq A:1-165,A:335-358 [30012]
    Other proteins in same PDB: d1gyqa2, d1gyqb2, d1gyqc2, d1gyqd2

Details for d1gyqa1

PDB Entry: 1gyq (more details), 3.4 Å

PDB Description: crystal structure of glycosomal glyceraldehyde from leishmania mexicana in complex with n6-benzyl-nad

SCOP Domain Sequences for d1gyqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gyqa1 c.2.1.3 (A:1-165,A:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana}
apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr
ymaakdaass

SCOP Domain Coordinates for d1gyqa1:

Click to download the PDB-style file with coordinates for d1gyqa1.
(The format of our PDB-style files is described here.)

Timeline for d1gyqa1: