SCOPe 2.05: Domain d1gypb1: 1gyp B:1-165,B:335-358

Lineage for d1gypb1 (1gyp B:1-165,B:335-358)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species Trypanosome (Leishmania mexicana) [TaxId:5665] [51809] (5 PDB entries)

8. Domain d1gypb1: 1gyp B:1-165,B:335-358 [30005]
   Other proteins in same PDB: d1gypa2, d1gypb2, d1gypc2, d1gypd2
   complexed with nad, po4

Details for d1gypb1

PDB Entry: 1gyp, 2.8 Å

PDB Description: crystal structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from leishmania mexicana: implications for structure-based drug design and a new position for the inorganic phosphate binding site

PDB Compounds: (B:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1gypb1:

Sequence; same for both SEQRES and ATOM records:

>d1gypb1 c.2.1.3 (B:1-165,B:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr
ymaakdaass

Timeline for d1gypb1:

• d1gypb1 first appeared (with stable ids) in SCOP 1.55
  
• d1gypb1 appears in SCOPe 2.04
  
• d1gypb1 appears in SCOPe 2.06
  
• d1gypb1 appears in the current release, SCOPe 2.08