Lineage for d1gypb1 (1gyp B:1-165,B:335-358)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687227Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 687423Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (18 species)
  7. 687509Species Leishmania mexicana [TaxId:5665] [51809] (5 PDB entries)
  8. 687523Domain d1gypb1: 1gyp B:1-165,B:335-358 [30005]
    Other proteins in same PDB: d1gypa2, d1gypb2, d1gypc2, d1gypd2

Details for d1gypb1

PDB Entry: 1gyp (more details), 2.8 Å

PDB Description: crystal structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from leishmania mexicana: implications for structure-based drug design and a new position for the inorganic phosphate binding site
PDB Compounds: (B:) glyceraldehyde-3-phosphate dehydrogenase

SCOP Domain Sequences for d1gypb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gypb1 c.2.1.3 (B:1-165,B:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana [TaxId: 5665]}
apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr
ymaakdaass

SCOP Domain Coordinates for d1gypb1:

Click to download the PDB-style file with coordinates for d1gypb1.
(The format of our PDB-style files is described here.)

Timeline for d1gypb1: