SCOP 1.55: Domain d1gypa1: 1gyp A:1-165,A:335-358

Lineage for d1gypa1 (1gyp A:1-165,A:335-358)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species)

7. Species Leishmania mexicana [TaxId:5665] [51809] (3 PDB entries)

8. Domain d1gypa1: 1gyp A:1-165,A:335-358 [30004]
   Other proteins in same PDB: d1gypa2, d1gypb2, d1gypc2, d1gypd2

Details for d1gypa1

PDB Entry: 1gyp, 2.8 Å

PDB Description: crystal structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from leishmania mexicana: implications for structure-based drug design and a new position for the inorganic phosphate binding site

SCOP Domain Sequences for d1gypa1:

Sequence; same for both SEQRES and ATOM records:

>d1gypa1 c.2.1.3 (A:1-165,A:335-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Leishmania mexicana}
apikvgingfgrigrmvfqaicdqgligteidvvavvdmstnaeyfayqmkhdtvhgrpk
ytveavksspsvetadvlvvnghrikcvkaqrnpadlpwgklgvdyviestglftdklka
eghikggakkvvisapasggaktivmgvnqheyspashhvvsnasXnewayshrvvdlvr
ymaakdaass

Timeline for d1gypa1:

• d1gypa1 appears in SCOP 1.57
  
• d1gypa1 appears in the current release, SCOPe 2.08