Lineage for d1ggaa1 (1gga A:1-164,A:334-358)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20314Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 20369Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species)
  7. 20454Species Trypanosoma brucei brucei, glycosome [TaxId:5702] [51808] (1 PDB entry)
  8. 20455Domain d1ggaa1: 1gga A:1-164,A:334-358 [30002]
    Other proteins in same PDB: d1ggaa2, d1ggab2, d1ggao2, d1ggap2, d1ggaq2, d1ggar2

Details for d1ggaa1

PDB Entry: 1gga (more details), 3.2 Å

PDB Description: structure of glycosomal glyceraldehyde-3-phosphate dehydrogenase from trypanosoma brucei determined from laue data
PDB Compounds: (A:)

SCOP Domain Sequences for d1ggaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggaa1 c.2.1.3 (A:1-164,A:334-358) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma brucei brucei, glycosome}
tikvgingfgrigrmvfqalcddgllgneidvvavvdmntdaryfayqmkydsvhgkfkh
svsttkskpsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftvksaae
ghlrggarkvvisapasggaktfvmgvnhnnynpreqhvvsnasXnewgyshrvvdlvrh
maardraakl

SCOP Domain Coordinates for d1ggaa1:

Click to download the PDB-style file with coordinates for d1ggaa1.
(The format of our PDB-style files is described here.)

Timeline for d1ggaa1: