Lineage for d1cf2r1 (1cf2 R:1-138,R:304-336)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 238223Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 238224Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 238741Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 238834Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (13 species)
  7. 238835Species Archaeon Methanothermus fervidus [TaxId:2180] [51807] (1 PDB entry)
  8. 238839Domain d1cf2r1: 1cf2 R:1-138,R:304-336 [29997]
    Other proteins in same PDB: d1cf2o2, d1cf2p2, d1cf2q2, d1cf2r2
    complexed with nap, so4

Details for d1cf2r1

PDB Entry: 1cf2 (more details), 2.1 Å

PDB Description: three-dimensional structure of d-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic archaeon methanothermus fervidus

SCOP Domain Sequences for d1cf2r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf2r1 c.2.1.3 (R:1-138,R:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus}
mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
nslsnyeesygkdytrvvXivpenvdavrailemeedkyksinktnkamnil

SCOP Domain Coordinates for d1cf2r1:

Click to download the PDB-style file with coordinates for d1cf2r1.
(The format of our PDB-style files is described here.)

Timeline for d1cf2r1: