Lineage for d1cf2r1 (1cf2 R:1-138,R:304-336)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20314Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 20369Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species)
  7. Species Methanothermus fervidus [TaxId:2180] [51807] (1 PDB entry)
  8. Domain d1cf2r1: 1cf2 R:1-138,R:304-336 [29997]
    Other proteins in same PDB: d1cf2o2, d1cf2p2, d1cf2q2, d1cf2r2

Details for d1cf2r1

PDB Entry: 1cf2 (more details), 2.1 Å

PDB Description: three-dimensional structure of d-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic archaeon methanothermus fervidus

SCOP Domain Sequences for d1cf2r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf2r1 c.2.1.3 (R:1-138,R:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Methanothermus fervidus}
mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
nslsnyeesygkdytrvvXivpenvdavrailemeedkyksinktnkamnil

SCOP Domain Coordinates for d1cf2r1 are not available.

Timeline for d1cf2r1:

Domains from same chain:
(mouse over for more information)
d1cf2r2
Domains from other chains:
(mouse over for more information)
d1cf2o1, d1cf2o2, d1cf2p1, d1cf2p2, d1cf2q1, d1cf2q2