Lineage for d1cf2p1 (1cf2 P:1-138,P:304-336)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 66135Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 66136Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) (S)
  5. 66547Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 66608Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species)
  7. 66680Species Methanothermus fervidus [TaxId:2180] [51807] (1 PDB entry)
  8. 66682Domain d1cf2p1: 1cf2 P:1-138,P:304-336 [29996]
    Other proteins in same PDB: d1cf2o2, d1cf2p2, d1cf2q2, d1cf2r2

Details for d1cf2p1

PDB Entry: 1cf2 (more details), 2.1 Å

PDB Description: three-dimensional structure of d-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic archaeon methanothermus fervidus

SCOP Domain Sequences for d1cf2p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cf2p1 c.2.1.3 (P:1-138,P:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Methanothermus fervidus}
mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
nslsnyeesygkdytrvvXivpenvdavrailemeedkyksinktnkamnil

SCOP Domain Coordinates for d1cf2p1:

Click to download the PDB-style file with coordinates for d1cf2p1.
(The format of our PDB-style files is described here.)

Timeline for d1cf2p1: