Lineage for d1cf2q1 (1cf2 Q:1-138,Q:304-336)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (9 families) 
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins) 
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species) 
Species Methanothermus fervidus [TaxId:2180] [51807] (1 PDB entry) 
Domain d1cf2q1: 1cf2 Q:1-138,Q:304-336 [29995]
Other proteins in same PDB: d1cf2o2, d1cf2p2, d1cf2q2, d1cf2r2
Details for d1cf2q1
PDB Entry: 1cf2 (more details), 2.1 Å
PDB Description: three-dimensional structure of d-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic archaeon methanothermus fervidus
SCOP Domain Sequences for d1cf2q1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cf2q1 c.2.1.3 (Q:1-138,Q:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Methanothermus fervidus}
mkavaingygtvgkrvadaiaqqddmkvigvsktrpdfearmalkkgydlyvaipervkl
fekagievagtvddmldeadividctpegigaknlkmykekgikaifqggekhediglsf
nslsnyeesygkdytrvvXivpenvdavrailemeedkyksinktnkamnil
SCOP Domain Coordinates for d1cf2q1:
Click to download the PDB-style file with coordinates for d1cf2q1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cf2q1:
View in 3D
