![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
![]() | Protein automated matches [226903] (40 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [311405] (6 PDB entries) |
![]() | Domain d4o4if1: 4o4i F:1-76 [299940] Other proteins in same PDB: d4o4ia1, d4o4ia2, d4o4ib1, d4o4ib2, d4o4ic1, d4o4ic2, d4o4id1, d4o4id2, d4o4ie_, d4o4if2 automated match to d3tiia1 complexed with acp, ca, ep, gdp, gtp, llm, mes, mg |
PDB Entry: 4o4i (more details), 2.4 Å
SCOPe Domain Sequences for d4o4if1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o4if1 c.30.1.0 (F:1-76) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq lvnyyrgadklcrkas
Timeline for d4o4if1: