Lineage for d4o4if1 (4o4i F:1-76)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862338Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2862339Protein automated matches [226903] (40 species)
    not a true protein
  7. 2862384Species Chicken (Gallus gallus) [TaxId:9031] [311405] (6 PDB entries)
  8. 2862388Domain d4o4if1: 4o4i F:1-76 [299940]
    Other proteins in same PDB: d4o4ia1, d4o4ia2, d4o4ib1, d4o4ib2, d4o4ic1, d4o4ic2, d4o4id1, d4o4id2, d4o4ie_, d4o4if2
    automated match to d3tiia1
    complexed with acp, ca, ep, gdp, gtp, llm, mes, mg

Details for d4o4if1

PDB Entry: 4o4i (more details), 2.4 Å

PDB Description: Tubulin-Laulimalide-Epothilone A complex
PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d4o4if1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o4if1 c.30.1.0 (F:1-76) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

SCOPe Domain Coordinates for d4o4if1:

Click to download the PDB-style file with coordinates for d4o4if1.
(The format of our PDB-style files is described here.)

Timeline for d4o4if1: