![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
![]() | Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins) Pfam PF03133; PubMed 22020298 |
![]() | Protein automated matches [310890] (2 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [311406] (3 PDB entries) |
![]() | Domain d4o4hf2: 4o4h F:77-378 [299938] Other proteins in same PDB: d4o4ha1, d4o4ha2, d4o4hb1, d4o4hb2, d4o4hc1, d4o4hc2, d4o4hd1, d4o4hd2, d4o4he_, d4o4hf1, d4o4hf3 automated match to d3tiia2 complexed with acp, ca, gdp, gol, gtp, llm, mg |
PDB Entry: 4o4h (more details), 2.1 Å
SCOPe Domain Sequences for d4o4hf2:
Sequence, based on SEQRES records: (download)
>d4o4hf2 d.142.1.10 (F:77-378) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi kl
>d4o4hf2 d.142.1.10 (F:77-378) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} lvkliktspelsesctwfpesyviyptnltderevflaaynrrregregnvwiakssegi lisseaselldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregv lrtssepynsanfqdktchltnhciqkeysknygryeegnemffeefnqylmdalnttle nsillqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaq klyaelcqgivdvaissvfplaptsifikl
Timeline for d4o4hf2: