Lineage for d4o4hf2 (4o4h F:77-378)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541719Family d.142.1.10: Tubulin tyrosine ligase (TTL) C-terminal domain-like [310626] (2 proteins)
    Pfam PF03133; PubMed 22020298
  6. 2541786Protein automated matches [310890] (2 species)
    not a true protein
  7. 2541787Species Chicken (Gallus gallus) [TaxId:9031] [311406] (3 PDB entries)
  8. 2541788Domain d4o4hf2: 4o4h F:77-378 [299938]
    Other proteins in same PDB: d4o4ha1, d4o4ha2, d4o4hb1, d4o4hb2, d4o4hc1, d4o4hc2, d4o4hd1, d4o4hd2, d4o4he_, d4o4hf1, d4o4hf3
    automated match to d3tiia2
    complexed with acp, ca, gdp, gol, gtp, llm, mg

Details for d4o4hf2

PDB Entry: 4o4h (more details), 2.1 Å

PDB Description: Tubulin-Laulimalide complex
PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d4o4hf2:

Sequence, based on SEQRES records: (download)

>d4o4hf2 d.142.1.10 (F:77-378) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnlktpvapaqngirhlinntrtderevflaayn
rrregregnvwiakssagakgegilisseaselldfideqgqvhviqkylekplllepgh
rkfdirswvlvdhlyniylyregvlrtssepynsanfqdktchltnhciqkeysknygry
eegnemffeefnqylmdalnttlensillqikhiirsclmciepaistkhlhyqsfqlfg
fdfmvdeelkvwlievngapacaqklyaelcqgivdvaissvfpladtgqktsqptsifi
kl

Sequence, based on observed residues (ATOM records): (download)

>d4o4hf2 d.142.1.10 (F:77-378) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
lvkliktspelsesctwfpesyviyptnltderevflaaynrrregregnvwiakssegi
lisseaselldfideqgqvhviqkylekplllepghrkfdirswvlvdhlyniylyregv
lrtssepynsanfqdktchltnhciqkeysknygryeegnemffeefnqylmdalnttle
nsillqikhiirsclmciepaistkhlhyqsfqlfgfdfmvdeelkvwlievngapacaq
klyaelcqgivdvaissvfplaptsifikl

SCOPe Domain Coordinates for d4o4hf2:

Click to download the PDB-style file with coordinates for d4o4hf2.
(The format of our PDB-style files is described here.)

Timeline for d4o4hf2: