Lineage for d1b7gq1 (1b7g Q:1-138,Q:301-340)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2843543Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2843784Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species)
  7. 2843964Species Sulfolobus solfataricus [TaxId:2287] [51806] (1 PDB entry)
  8. 2843966Domain d1b7gq1: 1b7g Q:1-138,Q:301-340 [29993]
    Other proteins in same PDB: d1b7go2, d1b7gq2
    CASP3
    complexed with so4

Details for d1b7gq1

PDB Entry: 1b7g (more details), 2.05 Å

PDB Description: glyceraldehyde 3-phosphate dehydrogenase
PDB Compounds: (Q:) protein (glyceraldehyde 3-phosphate dehydrogenase)

SCOPe Domain Sequences for d1b7gq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7gq1 c.2.1.3 (Q:1-138,Q:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Sulfolobus solfataricus [TaxId: 2287]}
mvnvavngygtigkrvadaiikqpdmklvgvaktspnyeafiahrrgiriyvpqqsikkf
eesgipvagtvedliktsdivvdttpngvgaqykpiylqlqrnaifqggekaevadisfs
alcnynealgkkyirvvsXesivvpenidairasmklmsaedsmritneslgilkgyli

SCOPe Domain Coordinates for d1b7gq1:

Click to download the PDB-style file with coordinates for d1b7gq1.
(The format of our PDB-style files is described here.)

Timeline for d1b7gq1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b7gq2