Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species) |
Species Sulfolobus solfataricus [TaxId:2287] [51806] (1 PDB entry) |
Domain d1b7gq1: 1b7g Q:1-138,Q:301-340 [29993] Other proteins in same PDB: d1b7go2, d1b7gq2 CASP3 complexed with so4 |
PDB Entry: 1b7g (more details), 2.05 Å
SCOPe Domain Sequences for d1b7gq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b7gq1 c.2.1.3 (Q:1-138,Q:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Sulfolobus solfataricus [TaxId: 2287]} mvnvavngygtigkrvadaiikqpdmklvgvaktspnyeafiahrrgiriyvpqqsikkf eesgipvagtvedliktsdivvdttpngvgaqykpiylqlqrnaifqggekaevadisfs alcnynealgkkyirvvsXesivvpenidairasmklmsaedsmritneslgilkgyli
Timeline for d1b7gq1: