Lineage for d1b7go1 (1b7g O:1-138,O:301-340)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1578283Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1578524Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1578690Species Sulfolobus solfataricus [TaxId:2287] [51806] (1 PDB entry)
  8. 1578691Domain d1b7go1: 1b7g O:1-138,O:301-340 [29992]
    Other proteins in same PDB: d1b7go2, d1b7gq2
    CASP3
    complexed with so4

Details for d1b7go1

PDB Entry: 1b7g (more details), 2.05 Å

PDB Description: glyceraldehyde 3-phosphate dehydrogenase
PDB Compounds: (O:) protein (glyceraldehyde 3-phosphate dehydrogenase)

SCOPe Domain Sequences for d1b7go1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Sulfolobus solfataricus [TaxId: 2287]}
mvnvavngygtigkrvadaiikqpdmklvgvaktspnyeafiahrrgiriyvpqqsikkf
eesgipvagtvedliktsdivvdttpngvgaqykpiylqlqrnaifqggekaevadisfs
alcnynealgkkyirvvsXesivvpenidairasmklmsaedsmritneslgilkgyli

SCOPe Domain Coordinates for d1b7go1:

Click to download the PDB-style file with coordinates for d1b7go1.
(The format of our PDB-style files is described here.)

Timeline for d1b7go1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b7go2