Lineage for d1hdgq1 (1hdg Q:1-148,Q:313-331)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308470Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 308576Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (14 species)
  7. 308699Species Thermotoga maritima [TaxId:243274] [51805] (1 PDB entry)
  8. 308701Domain d1hdgq1: 1hdg Q:1-148,Q:313-331 [29991]
    Other proteins in same PDB: d1hdgo2, d1hdgq2
    complexed with nad, so4

Details for d1hdgq1

PDB Entry: 1hdg (more details), 2.5 Å

PDB Description: the crystal structure of holo-glyceraldehyde-3-phosphate dehydrogenase from the hyperthermophilic bacterium thermotoga maritima at 2.5 angstroms resolution

SCOP Domain Sequences for d1hdgq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hdgq1 c.2.1.3 (Q:1-148,Q:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima}
arvaingfgrigrlvyriiyerknpdievvaindltdtktlahllkydsvhkkfpgkvey
tenslivdgkeikvfaepdpsklpwkdlgvdfviestgvfrnrekaelhlqagakkviit
apakgeditvvigcnedqlkpehtiiscasXneygysnrvvdtlelllkm

SCOP Domain Coordinates for d1hdgq1:

Click to download the PDB-style file with coordinates for d1hdgq1.
(The format of our PDB-style files is described here.)

Timeline for d1hdgq1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hdgq2