Lineage for d1cerr1 (1cer R:1-148,R:313-333)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 19977Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 19978Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) (S)
  5. 20314Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (9 proteins)
  6. 20369Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (11 species)
  7. 20449Species Thermus aquaticus [TaxId:271] [51804] (1 PDB entry)
  8. 20453Domain d1cerr1: 1cer R:1-148,R:313-333 [29989]
    Other proteins in same PDB: d1cero2, d1cerp2, d1cerq2, d1cerr2

Details for d1cerr1

PDB Entry: 1cer (more details), 2.5 Å

PDB Description: determinants of enzyme thermostability observed in the molecular structure of thermus aquaticus d-glyceraldehyde-3-phosphate dehydrogenase at 2.5 angstroms resolution

SCOP Domain Sequences for d1cerr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cerr1 c.2.1.3 (R:1-148,R:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus}
mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
kgeditivmgvnheaydpsrhhiisnasXnewgyanrvadlvelvlrkgv

SCOP Domain Coordinates for d1cerr1:

Click to download the PDB-style file with coordinates for d1cerr1.
(The format of our PDB-style files is described here.)

Timeline for d1cerr1: