Lineage for d1cerp1 (1cer P:1-148,P:313-333)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308470Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 308576Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (14 species)
  7. 308702Species Thermus aquaticus [TaxId:271] [51804] (1 PDB entry)
  8. 308704Domain d1cerp1: 1cer P:1-148,P:313-333 [29988]
    Other proteins in same PDB: d1cero2, d1cerp2, d1cerq2, d1cerr2

Details for d1cerp1

PDB Entry: 1cer (more details), 2.5 Å

PDB Description: determinants of enzyme thermostability observed in the molecular structure of thermus aquaticus d-glyceraldehyde-3-phosphate dehydrogenase at 2.5 angstroms resolution

SCOP Domain Sequences for d1cerp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cerp1 c.2.1.3 (P:1-148,P:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus}
mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
kgeditivmgvnheaydpsrhhiisnasXnewgyanrvadlvelvlrkgv

SCOP Domain Coordinates for d1cerp1:

Click to download the PDB-style file with coordinates for d1cerp1.
(The format of our PDB-style files is described here.)

Timeline for d1cerp1: