| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) ![]() |
| Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins) family members also share a common alpha+beta fold in C-terminal domain |
| Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (14 species) |
| Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (10 PDB entries) |
| Domain d3dbvr1: 3dbv R:0-148,R:313-333 [29985] Other proteins in same PDB: d3dbvo2, d3dbvp2, d3dbvq2, d3dbvr2 complexed with nad, so4; mutant |
PDB Entry: 3dbv (more details), 2.45 Å
SCOP Domain Sequences for d3dbvr1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dbvr1 c.2.1.3 (R:0-148,R:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503}
avkvgingfgrigrnvfraalknpdievvavndtggantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl
Timeline for d3dbvr1: