Lineage for d3dbvq1 (3dbv Q:0-148,Q:313-333)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1578283Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1578524Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1578535Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (11 PDB entries)
  8. 1578578Domain d3dbvq1: 3dbv Q:0-148,Q:313-333 [29984]
    Other proteins in same PDB: d3dbvo2, d3dbvp2, d3dbvq2, d3dbvr2
    complexed with nad, so4; mutant

Details for d3dbvq1

PDB Entry: 3dbv (more details), 2.45 Å

PDB Description: glyceraldehyde-3-phosphate dehydrogenase mutant with leu 33 replaced by thr, thr 34 replaced by gly, asp 36 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nad+
PDB Compounds: (Q:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d3dbvq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dbvq1 c.2.1.3 (Q:0-148,Q:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
avkvgingfgrigrnvfraalknpdievvavndtggantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOPe Domain Coordinates for d3dbvq1:

Click to download the PDB-style file with coordinates for d3dbvq1.
(The format of our PDB-style files is described here.)

Timeline for d3dbvq1: