Lineage for d2gd1r1 (2gd1 R:0-148,R:313-333)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 975118Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 975119Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 976724Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 976928Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 976939Species Bacillus stearothermophilus, nca 1503 [TaxId:1422] [51803] (11 PDB entries)
  8. 976979Domain d2gd1r1: 2gd1 R:0-148,R:313-333 [29981]
    Other proteins in same PDB: d2gd1o2, d2gd1p2, d2gd1q2, d2gd1r2
    complexed with so4

Details for d2gd1r1

PDB Entry: 2gd1 (more details), 2.5 Å

PDB Description: coenzyme-induced conformational changes in glyceraldehyde-3-phosphate dehydrogenase from bacillus stearothermophillus
PDB Compounds: (R:) apo-d-glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2gd1r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gd1r1 c.2.1.3 (R:0-148,R:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]}
avkvgingfgrigrnvfraalknpdievvavndltdantlahllkydsvhgrldaevsvn
gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
pakneditivmgvnqdkydpkahhvisnasXnetgyshrvvdlaayiaskgl

SCOPe Domain Coordinates for d2gd1r1:

Click to download the PDB-style file with coordinates for d2gd1r1.
(The format of our PDB-style files is described here.)

Timeline for d2gd1r1: